PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G246900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 265aa    MW: 28405.6 Da    PI: 8.3496
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G246900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.4e-161663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT eEd+ lv ++ q+G g+W+  ar  g++R +k+c++rw++yl
  Sevir.5G246900.1.p 16 KGPWTLEEDLVLVGYISQHGEGSWDNLARAAGLNRNGKSCRLRWLNYL 63
                        79********************************************97 PP

2Myb_DNA-binding47.54.3e-1569112146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T+ Ed  + ++++ lG++ W++Ia++++ gRt++++k++w++
  Sevir.5G246900.1.p  69 RGSITPAEDAVIRELHATLGNK-WSKIAAHLP-GRTDNEIKNYWRT 112
                         7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.1361167IPR017930Myb domain
SuperFamilySSF466894.12E-3014110IPR009057Homeodomain-like
SMARTSM007175.9E-121565IPR001005SANT/Myb domain
PfamPF002491.4E-131663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-191769IPR009057Homeodomain-like
CDDcd001672.01E-91863No hitNo description
PROSITE profilePS5129419.07668118IPR017930Myb domain
SMARTSM007171.5E-1368116IPR001005SANT/Myb domain
PfamPF002491.1E-1369112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2470116IPR009057Homeodomain-like
CDDcd001675.67E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRTMCGRAG EPAVRKGPWT LEEDLVLVGY ISQHGEGSWD NLARAAGLNR NGKSCRLRWL  60
NYLRPGVRRG SITPAEDAVI RELHATLGNK WSKIAAHLPG RTDNEIKNYW RTRIQKRPAA  120
PANTQQQPCR APAAAPTTAT AASEGASSSS SASASHGSSA AEDYYYWCMK PNNPDQQACY  180
SHKTVAAAAA VGLGGWSASA ALTRQDSSST STTAGDGCKL TGYSYPYYFE LGSVADGVMM  240
VDADNFWNVV DNFWGTLPFP DATF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26101171107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281931e-128KJ728193.1 Zea mays clone pUT6467 MYB transcription factor (MYB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969272.10.0PREDICTED: myb-related protein 340-like
SwissprotP813963e-57MYB40_ANTMA; Myb-related protein 340
TrEMBLK3XPY50.0K3XPY5_SETIT; Uncharacterized protein
STRINGSi003965m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-56myb domain protein 21